Search
Category : Keyword :


PROTEIN
MASLPLGPQPHALAPPLQLHDGDALKRRPELDSDKEMSAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGESVAIKKVLQDRRYKNRELQLMRPMDHPNVISLKHCFFSTTSRDELFLNLVMEYVPETLYRVLRHYTSSNQRMPIFYVKLYTYQIFRGLAYIHTVPGVCHRDVKPQNLLVDPLTHQVKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTASIDIWSAGCVLAELLLGQPLFPGENSVDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFNELREPNARLPNGRPLPPLFNFKQELGGASMELINRLIPEHVRRQMSTGLQNS
NUCLEOTIDE
ATGGCCTCATTACCATTGGGGCCTCAGCCTCATGCTCTTGCTCCGCCGCTGCAGCTTCACGACGGCGACGCTTTGAAACGCCGTCCTGAATTGGATTCTGATAAGGAAATGTCTGCAGCTGTTATTGAGGGAAATGACGCTGTTACTGGTCATATCATTTCCACTACTATTGGAGGCAAAAACGGCGAACCAAAGCAGACCATTAGTTACATGGCTGAGCGGGTTGTTGGAACAGGTTCATTCGGGATTGTTTTTCAGGCGAAATGCTTGGAAACTGGAGAATCAGTAGCCATTAAAAAGGTCTTGCAAGATCGACGCTATAAAAACCGTGAGTTGCAACTAATGCGACCAATGGATCACCCAAATGTCATCTCCTTGAAGCACTGTTTCTTCTCTACAACGAGTAGAGATGAGCTCTTCCTCAACCTTGTTATGGAGTATGTACCTGAGACTTTATACCGGGTTTTGAGGCACTATACTAGTTCTAATCAGAGGATGCCAATTTTCTATGTCAAGCTTTACACATATCAAATCTTTAGAGGTTTGGCTTACATCCATACTGTTCCCGGTGTTTGCCACAGAGATGTGAAACCACAAAATCTCTTGGTTGATCCCTTGACCCATCAGGTTAAGCTGTGTGATTTTGGAAGTGCAAAAGTATTGGTCAAAGGTGAACCAAACATATCATATATCTGCTCCCGTTATTATCGTGCTCCAGAACTGATCTTTGGCGCCACAGAGTATACAGCATCCATAGATATATGGTCTGCTGGTTGTGTACTGGCAGAGCTTCTTCTGGGCCAGCCGTTATTTCCAGGAGAAAATTCAGTTGATCAGCTTGTGGAGATCATAAAGGTTCTTGGTACTCCAACTCGTGAAGAAATTCGATGTATGAACCCGAACTACACAGATTTTAGGTTCCCACAAATCAAAGCTCACCCTTGGCACAAGGTTTTTCATAAACGGATGCCTCCAGAAGCAATAGACCTTGCATCTCGGCTTCTTCAATATTCACCAAGTCTACGCTGCACTGCGCTCGAAGCATGTGCTCATCCGTTTTTCAATGAACTCCGAGAGCCAAACGCCCGTCTTCCAAATGGTCGTCCATTACCGCCATTGTTCAATTTCAAACAAGAGTTAGGTGGAGCTTCAATGGAGCTAATCAACAGGCTAATACCTGAGCATGTGAGACGACAAATGAGCACAGGATTACAAAACAGTTAA

Notice: Undefined variable: i in /opt/lampp/htdocs/srgdb/seq.php on line 48