Search
Category : Keyword :


PROTEIN
MASLPLGPQPHALAPPLQLHDGDALKRRPELDSDKEMSAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGESVAIKKVLQDRRYKNRELQLMRPMDHPNVISLKHCFFSTTSRDELFLNLVMEYVPETLYRVLRHYTSSNQRMPIFYVKLYTYQIFRGLAYIHTVPGVCHRDVKPQNLLVDPLTHQVKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTASIDIWSAGCVLAELLLGQPLFPGENSVDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFNELREPNARLPNGRPLPPLFNFKQELGGASMELINRLIPEHVRRQMSTGLQNS
NUCLEOTIDE
ATGGCCTCATTACCATTGGGGCCTCAGCCTCATGCTCTTGCTCCGCCGCTGCAGCTTCACGACGGCGACGCTTTGAAACGCCGTCCTGAATTGGATTCTGATAAGGAAATGTCTGCAGCTGTTATTGAGGGAAATGACGCTGTTACTGGTCATATCATTTCCACTACTATTGGAGGCAAAAACGGCGAACCAAAGCAGACCATTAGTTACATGGCTGAGCGGGTTGTTGGAACAGGTTCATTCGGGATTGTTTTTCAGGCGAAATGCTTGGAAACTGGAGAATCAGTAGCCATTAAAAAGGTCTTGCAAGATCGACGCTATAAAAACCGTGAGTTGCAACTAATGCGACCAATGGATCACCCAAATGTCATCTCCTTGAAGCACTGTTTCTTCTCTACAACGAGTAGAGATGAGCTCTTCCTCAACCTTGTTATGGAGTATGTACCTGAGACTTTATACCGGGTTTTGAGGCACTATACTAGTTCTAATCAGAGGATGCCAATTTTCTATGTCAAGCTTTACACATATCAAATCTTTAGAGGTTTGGCTTACATCCATACTGTTCCCGGTGTTTGCCACAGAGATGTGAAACCACAAAATCTCTTGGTTGATCCCTTGACCCATCAGGTTAAGCTGTGTGATTTTGGAAGTGCAAAAGTATTGGTCAAAGGTGAACCAAACATATCATATATCTGCTCCCGTTATTATCGTGCTCCAGAACTGATCTTTGGCGCCACAGAGTATACAGCATCCATAGATATATGGTCTGCTGGTTGTGTACTGGCAGAGCTTCTTCTGGGCCAGCCGTTATTTCCAGGAGAAAATTCAGTTGATCAGCTTGTGGAGATCATAAAGGTTCTTGGTACTCCAACTCGTGAAGAAATTCGATGTATGAACCCGAACTACACAGATTTTAGGTTCCCACAAATCAAAGCTCACCCTTGGCACAAGGTTTTTCATAAACGGATGCCTCCAGAAGCAATAGACCTTGCATCTCGGCTTCTTCAATATTCACCAAGTCTACGCTGCACTGCGCTCGAAGCATGTGCTCATCCGTTTTTCAATGAACTCCGAGAGCCAAACGCCCGTCTTCCAAATGGTCGTCCATTACCGCCATTGTTCAATTTCAAACAAGAGTTAGGTGGAGCTTCAATGGAGCTAATCAACAGGCTAATACCTGAGCATGTGAGACGACAAATGAGCACAGGATTACAAAACAGTTAA