Search
Category : Keyword :


PROTEIN
MGKREIHFTPVGRQVQRVLEYPLRLENRSPMSYSRRSRYSPSLSPYDKRRGRSVSRSLSRSPTRSVSSDAENPGNSLYVTGLSHRVTERDLEDHFAKEGKVTDVHLVLDPWTRESRGFGFISMKSVGDANRCIRSLDHSVLQGRVITVEKARRRRGRTPTPGKYLGLRTARGRHKSPSYSPRRSVSCSRSRSRSYSSDRGRSYSPSYGRRGRSSSYSPFYRRRRFYSPSRSPSPDDRYNRRRDRSYSPYYRRRDRSRSYSRNCRARDRSPYYMRRYRSRSRSYSPRYRARDRSCSPYYRGRDRSYSPHYQGRDRSYSPESRYYRRHRSVSGSVSPGGRSMSRSISPRKGRKESRSKSRRHDRQSSMCHSRSARSSTSRSVSP
NUCLEOTIDE
ATGGGGAAACGTGAAATTCATTTTACTCCGGTGGGTCGTCAGGTGCAGAGAGTTCTGGAATATCCATTGCGCTTGGAGAATCGTTCGCCGATGTCTTACTCAAGAAGGTCAAGATACTCTCCTTCACTATCTCCTTATGACAAGCGTCGTGGAAGGTCTGTGTCAAGGTCATTGTCTAGAAGCCCGACGAGGAGTGTCTCAAGCGATGCTGAGAATCCTGGTAACAGTTTATATGTAACTGGATTGTCTCACCGGGTTACTGAAAGAGATCTGGAGGATCATTTCGCTAAAGAAGGAAAGGTAACTGATGTTCACCTTGTCCTGGACCCATGGACTAGAGAATCTCGCGGATTTGGTTTTATCTCTATGAAAAGTGTTGGTGATGCTAACCGTTGCATCAGATCTCTAGATCACTCTGTTCTGCAGGGCCGCGTCATCACTGTTGAGAAGGCAAGACGTCGTAGAGGACGTACTCCAACTCCAGGAAAGTACTTGGGGCTGAGAACTGCTCGAGGACGACATAAGTCTCCTAGCTACTCTCCCCGCAGGTCTGTTAGCTGCTCTCGTAGTCGTAGTCGAAGCTACTCATCTGATCGGGGCAGATCTTATTCTCCAAGCTATGGGAGAAGAGGAAGGTCATCCTCGTACTCACCCTTCTATCGACGACGCAGATTCTACTCTCCTTCGAGATCTCCTTCACCTGATGATCGTTACAACAGGAGACGCGACAGATCATACTCACCTTACTACAGGCGGAGGGACCGGTCCAGATCCTACTCACGTAACTGTAGAGCACGGGACAGATCACCTTACTACATGCGGAGGTACAGGTCCAGATCCAGGTCATACTCGCCTCGCTACAGAGCACGTGACCGATCATGCTCACCCTACTACAGGGGAAGAGACCGGTCTTATTCACCCCACTACCAAGGGAGAGACAGATCCTACTCACCTGAAAGTCGTTACTACAGAAGGCACAGGTCGGTATCGGGAAGCGTAAGCCCTGGAGGGAGAAGCATGTCACGTAGCATATCCCCAAGGAAGGGAAGGAAAGAGAGCAGAAGCAAGTCTCGGAGGCACGACAGGCAATCTTCAATGTGTCATTCGAGGAGCGCAAGATCAAGCACCTCCAGATCCGTCAGCCCATAA